PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG100100.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 267aa    MW: 29259.8 Da    PI: 10.2892
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG100100.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.74e-18107161256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ ++tkeq   Le+ F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Pavir.9KG100100.2.p 107 RKKLRLTKEQSALLEDRFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRARTK 161
                          788899***********************************************98 PP

2HD-ZIP_I/II125.81.9e-40107196191
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          +kk+rl+keq++lLE+ F+e+++L+p++Kv+la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL++e +eLr +
  Pavir.9KG100100.2.p 107 RKKLRLTKEQSALLEDRFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCESLTEENRRLQRELQELR-A 195
                          69*************************************************************************************9.5 PP

          HD-ZIP_I/II  91 l 91 
                          l
  Pavir.9KG100100.2.p 196 L 196
                          5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.7E-1891162IPR009057Homeodomain-like
SuperFamilySSF466899.61E-19101164IPR009057Homeodomain-like
PROSITE profilePS5007117.232103163IPR001356Homeobox domain
SMARTSM003897.8E-16105167IPR001356Homeobox domain
PfamPF000461.8E-15107161IPR001356Homeobox domain
CDDcd000862.14E-14107164No hitNo description
PROSITE patternPS000270138161IPR017970Homeobox, conserved site
PfamPF021833.1E-11163197IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.0E-22163206IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MAQEDVHLDD AGLALGLSLG GGAAPDAARR QGAGARLPPS PRALEPSLTL SMPDEATATG  60
SAGGGAAHSV SSSLPAAGVK RERVEEADGE RASSTARAED DDDGSTRKKL RLTKEQSALL  120
EDRFKEHSTL NPKQKVALAK QLNLRPRQVE VWFQNRRART KLKQTEVDCE FLKRCCESLT  180
EENRRLQREL QELRALKFAA PPGRRRRTTS STPSPTPPPA DHLICTRMHG DHQQQQHRAE  240
KHHPPPLQLA NTTTYTPSNP PRVRHK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1105111TRKKLRL
2155163RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0357541e-126BT035754.2 Zea mays full-length cDNA clone ZM_BFb0081O05 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985119.11e-92PREDICTED: homeobox-leucine zipper protein HOX19 isoform X2
SwissprotA2XE761e-77HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL41e-77HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLB4FF662e-81B4FF66_MAIZE; Uncharacterized protein
TrEMBLC5WRR42e-81C5WRR4_SORBI; Putative uncharacterized protein Sb01g042030
STRINGSb01g042030.15e-81(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.15e-48homeobox from Arabidopsis thaliana